Peptide-Based Vectors for Gene Delivery
Abstract
:1. Introduction
2. Plasmid DNA (pDNA)
3. Delivery Barriers of Gene Therapy
4. Peptide-Based Gene Delivery Vectors
4.1. Peptides Act as DNA-Binding Units
4.1.1. Poly-l-lysines (PLLs)
4.1.2. Arginine-Rich Peptides
4.1.3. Poly-l-ornithine (PLO)
4.2. Peptides Act as Functional Moieties
4.2.1. Cell-Targeting Peptides
4.2.2. Cell-Penetrating Peptides
4.2.3. Endosomal Escape Peptides
4.2.4. Nuclear-Localizing Peptides
4.3. Chimeric Peptide for Gene Delivery
5. Conclusions
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Fan, W.; Yung, B.; Huang, P.; Chen, X. Nanotechnology for multimodal synergistic cancer therapy. Chem. Rev. 2017, 117, 13566–13638. [Google Scholar] [CrossRef]
- Somia, N.; Verma, I.M. Gene therapy: Trials and tribulations. Nat. Rev. Genet. 2000, 1, 91–99. [Google Scholar] [CrossRef] [PubMed]
- Reszka, E.; Jablonowski, Z.; Wieczorek, E.; Jablonska, E.; Krol, M.B.; Gromadzinska, J.; Grzegorczyk, A.; Sosnowski, M.; Wasowicz, W. Polymorphisms of NRF2 and NRF2 target genes in urinary bladder cancer patients. J. Cancer Res. Clin. 2014, 140, 1723–1731. [Google Scholar] [CrossRef] [Green Version]
- Gharanei, S.; Shabir, K.; Brown, J.E.; Weickert, M.O.; Barber, T.M.; Kyrou, I.; Randeva, H.S. Regulatory microRNAs in brown, brite and white adipose tissue. Cells 2020, 9, 2489. [Google Scholar] [CrossRef] [PubMed]
- Bengtsson, N.E.; Hall, J.K.; Odom, G.L.; Phelps, M.P.; Andrus, C.R.; Hawkins, R.D.; Hauschka, S.D.; Chamberlain, J.R.; Chamberlain, J.S. Muscle-specific CRISPR/Cas9 dystrophin gene editing ameliorates pathophysiology in a mouse model for duchenne muscular dystrophy. Nat. Commun. 2017, 8, 14454. [Google Scholar] [CrossRef] [Green Version]
- Alaee, F.; Sugiyama, O.; Virk, M.S.; Tang, H.; Drissi, H.; Lichtler, A.C.; Lieberman, J.R. Suicide gene approach using a dual-expression lentiviral vector to enhance the safety of ex vivo gene therapy for bone repair. Gene Ther. 2013, 21, 139–147. [Google Scholar] [CrossRef] [Green Version]
- Huang, Y.; Hong, J.; Zheng, S.; Ding, Y.; Guo, S.; Zhang, H.; Zhang, X.; Du, Q.; Liang, Z. Elimination pathways of systemically delivered siRNA. Mol. Ther. 2011, 19, 381–385. [Google Scholar] [CrossRef]
- Midoux, P.; Pichon, C.; Yaouanc, J.-J.; Jaffrès, P.-A. Chemical vectors for gene delivery: A current review on polymers, peptides and lipids containing histidine or imidazole as nucleic acids carriers. Br. J. Pharmacol. 2009, 157, 166–178. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhang, M.; Guo, X.; Wang, M.; Liu, K. Tumor microenvironment-induced structure changing drug/gene delivery system for overcoming delivery-associated challenges. J. Control. Release 2020, 323, 203–224. [Google Scholar] [CrossRef]
- Tefas, L.R.; Sylvester, B.; Tomuta, I.; Sesarman, A.; Licarete, E.; Banciu, M.; Porfire, A. Development of antiproliferative long-circulating liposomes co-encapsulating doxorubicin and curcumin, through the use of a quality-by-design approach. Drug Des. Devel. Ther. 2017, 11, 1605–1621. [Google Scholar] [CrossRef] [Green Version]
- Zhu, F.-C.; Hou, L.-H.; Li, J.-X.; Wu, S.-P.; Liu, P.; Zhang, G.-R.; Hu, Y.-M.; Meng, F.-Y.; Xu, J.-J.; Tang, R.; et al. Safety and immunogenicity of a novel recombinant adenovirus type-5 vector-based Ebola vaccine in healthy adults in China: Preliminary report of a randomised, double-blind, placebo-controlled, phase 1 trial. Lancet 2015, 385, 2272–2279. [Google Scholar] [CrossRef] [PubMed]
- Finer, M.; Glorioso, J. A brief account of viral vectors and their promise for gene therapy. Gene Ther. 2017, 24, 1–2. [Google Scholar] [CrossRef] [Green Version]
- Shirley, J.L.; de Jong, Y.P.; Terhorst, C.; Herzog, R.W. Immune responses to viral gene therapy vectors. Mol. Ther. 2020, 28, 709–722. [Google Scholar] [CrossRef] [PubMed]
- Lukashev, A.N.; Zamyatnin, A.A. Viral vectors for gene therapy: Current state and clinical perspectives. Biochemistry 2016, 81, 700–708. [Google Scholar] [CrossRef] [PubMed]
- Mohammadinejad, R.; Dehshahri, A.; Sagar Madamsetty, V.; Zahmatkeshan, M.; Tavakol, S.; Makvandi, P.; Khorsandi, D.; Pardakhty, A.; Ashrafizadeh, M.; Ghasemipour Afshar, E.; et al. In vivo gene delivery mediated by non-viral vectors for cancer therapy. J. Control. Release 2020, 325, 249–275. [Google Scholar] [CrossRef]
- Xu, X.; Liu, A.; Bai, Y.; Li, Y.; Zhang, C.; Cui, S.; Piao, Y.; Zhang, S. Co-delivery of resveratrol and p53 gene via peptide cationic liposomal nanocarrier for the synergistic treatment of cervical cancer and breast cancer cells. J. Drug Deliv. Sci. Technol. 2019, 51, 746–753. [Google Scholar] [CrossRef]
- Lin, Y.-X.; Wang, Y.; An, H.-W.; Qi, B.; Wang, J.; Wang, L.; Shi, J.; Mei, L.; Wang, H. Peptide-based autophagic gene and cisplatin co-delivery systems enable improved chemotherapy resistance. Nano Lett. 2019, 19, 2968–2978. [Google Scholar] [CrossRef]
- Leung, H.M.; Chan, M.S.; Liu, L.S.; Wong, S.W.; Lo, T.W.; Lau, C.-H.; Tin, C.; Lo, P.K. Dual-function, cationic, peptide-coated nanodiamond systems: Facilitating nuclear-targeting delivery for enhanced gene therapy applications. ACS Sustain. Chem. Eng. 2018, 6, 9671–9681. [Google Scholar] [CrossRef]
- Qi, G.-B.; Gao, Y.-J.; Wang, L.; Wang, H. Self-assembled peptide-based nanomaterials for biomedical imaging and therapy. Adv. Mater. 2018, 30, e1703444. [Google Scholar] [CrossRef]
- Hou, K.K.; Pan, H.; Lanza, G.M.; Wickline, S.A. Melittin derived peptides for nanoparticle based siRNA transfection. Biomaterials 2013, 34, 3110–3119. [Google Scholar] [CrossRef] [Green Version]
- Martin, M.E.; Rice, K.G. Peptide-guided gene delivery. AAPS J. 2007, 9, E18–E29. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lehto, T.; Ezzat, K.; Wood, M.J.A.; El Andaloussi, S. Peptides for nucleic acid delivery. Adv. Drug. Deliv. Rev. 2016, 106, 172–182. [Google Scholar] [CrossRef] [PubMed]
- Urello, M.; Hsu, W.-H.; Christie, R.J. Peptides as a material platform for gene delivery: Emerging concepts and converging technologies. Acta Biomater. 2020, 117, 40–59. [Google Scholar] [CrossRef] [PubMed]
- Saccardo, P.; Villaverde, A.; Gonzalez-Montalban, N. Peptide-mediated DNA condensation for non-viral gene therapy. Biotechnol. Adv. 2009, 27, 432–438. [Google Scholar] [CrossRef]
- Cummings, J.C.; Zhang, H.; Jakymiw, A. Peptide carriers to the rescue: Overcoming the barriers to siRNA delivery for cancer treatment. Transl. Res. 2019, 214, 92–104. [Google Scholar] [CrossRef] [PubMed]
- Ahmed, M. Peptides, polypeptides and peptide–polymer hybrids as nucleic acid carriers. Biomater. Sci. 2017, 5, 2188–2211. [Google Scholar] [CrossRef]
- Oh, J.; Lee, J.; Piao, C.; Jeong, J.H.; Lee, M. A self-assembled DNA-nanoparticle with a targeting peptide for hypoxia-inducible gene therapy of ischemic stroke. Biomater. Sci. 2019, 7, 2174–2190. [Google Scholar] [CrossRef]
- Kang, Z.; Meng, Q.; Liu, K. Peptide-based gene delivery vectors. J. Mater. Chem. B 2019, 7, 1824–1841. [Google Scholar] [CrossRef]
- Yang, Q.; Zhou, Y.; Chen, J.; Huang, N.; Wang, Z.; Cheng, Y. Gene therapy for drug-resistant glioblastoma via lipid-polymer hybrid nanoparticles combined with focused ultrasound. Int. J. Nanomed. 2021, 16, 185–199. [Google Scholar] [CrossRef]
- Shimamura, M.; Morishita, R. Naked plasmid DNA for gene therapy. Curr. Gene Ther. 2011, 11, 433. [Google Scholar] [CrossRef]
- Chen, J.; Guo, Z.; Tian, H.; Chen, X. Production and clinical development of nanoparticles for gene delivery. Mol. Ther. Methods Clin. Dev. 2016, 3, 16023. [Google Scholar] [CrossRef] [PubMed]
- Muhammad, K.; Zhao, J.; Ullah, I.; Guo, J.; Ren, X.-k.; Feng, Y. Ligand targeting and peptide functionalized polymers as non-viral carriers for gene therapy. Biomater. Sci. 2020, 8, 64–83. [Google Scholar] [CrossRef] [PubMed]
- Suk, J.S.; Xu, Q.; Kim, N.; Hanes, J.; Ensign, L.M. PEGylation as a strategy for improving nanoparticle-based drug and gene delivery. Adv. Drug Deliv. Rev. 2016, 99, 28–51. [Google Scholar] [CrossRef] [Green Version]
- Ogris, M.; Brunner, S.; Schuller, S.; Kircheis, R.; Wagner, E. PEGylated DNA/transferring-PEI complexes: Reduced interaction with blood components, extended cireulation in blood and Potential for systemic gene delivery. Gene Ther. 1999, 6, 595–605. [Google Scholar] [CrossRef] [Green Version]
- Lai, T.C.; Kataoka, K.; Kwon, G.S. Bioreducible polyether-based pDNA ternary polyplexes: Balancing particle stability and transfection efficiency. Colloids Surf. B Biointerfaces 2012, 99, 27–37. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hsu, S.H.; Ho, T.T.; Tseng, T.C. Nanoparticle uptake and gene transfer efficiency for MSCs on chitosan and chitosan-hyaluronan substrates. Biomaterials 2012, 33, 3639–3650. [Google Scholar] [CrossRef]
- Ma, H.; Guo, Y.; Tang, H.; Tseng, C.-T.K.; Wang, L.; Zong, H.; Wang, Z.; He, Y.; Chang, Y.; Wang, S.; et al. Broad ultra-potent neutralization of SARS-CoV-2 variants by monoclonal antibodies specific to the tip of RBD. Cell Discov. 2022, 8, 16. [Google Scholar] [CrossRef]
- Chen, S.; Rong, L.; Lei, Q.; Cao, P.-X.; Qin, S.-Y.; Zheng, D.-W.; Jia, H.-Z.; Zhu, J.-Y.; Cheng, S.-X.; Zhuo, R.-X.; et al. A surface charge-switchable and folate modified system for co-delivery of proapoptosis peptide and p53 plasmid in cancer therapy. Biomaterials 2016, 77, 149–163. [Google Scholar] [CrossRef]
- Fu, S.; Xu, X.; Ma, Y.; Zhang, S.; Zhang, S. RGD peptide-based non-viral vectors targeting integrin αvβ3for cancer therapy. J. Drug Target. 2018, 27, 1–11. [Google Scholar] [CrossRef]
- Valsalakumari, J.; Baby, J.; Bijin, E.; Constantine, I.; Manjila, S.; Pramod, K. Novel gene delivery systems. Int. J. Pharm. Investig. 2013, 3, 1–7. [Google Scholar] [CrossRef] [Green Version]
- Lee, D.U.; Park, J.-Y.; Kwon, S.; Park, J.Y.; Kim, Y.H.; Khang, D.; Hong, J.H. Apoptotic lysosomal proton sponge effect in tumor tissue by cationic gold nanorods. Nanoscale 2019, 11, 19980–19993. [Google Scholar] [CrossRef] [PubMed]
- Ali, L.M.A.; Gary-Bobo, M. Photochemical Internalization of siRNA for Cancer Therapy. Cancers 2022, 14, 3597. [Google Scholar] [CrossRef] [PubMed]
- Teo, S.L.Y.; Rennick, J.J.; Yuen, D.; Al-Wassiti, H.; Johnston, A.P.R.; Pouton, C.W. Unravelling cytosolic delivery of cell penetrating peptides with a quantitative endosomal escape assay. Nat. Commun. 2021, 12, 3721. [Google Scholar] [CrossRef] [PubMed]
- Behr, J.P. The Proton Sponge: A Trick to Enter Cells the Viruses Did Not Exploit. Chimia 1997, 51, 34–36. [Google Scholar] [CrossRef]
- Lin, D.H.; Hoelz, A. The Structure of the Nuclear Pore Complex (An Update). Ann. Rev. Biochem. 2019, 88, 725–783. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Paci, G.; Caria, J.; Lemke, E.A. Cargo transport through the nuclear pore complex at a glance. J. Cell Sci. 2021, 134, jcs247874. [Google Scholar] [CrossRef]
- Zhang, W.; Chen, Q.; Wu, F.; Dai, J.; Ding, D.; Wu, J.; Lou, X.; Xia, F. Peptide-based nanomaterials for gene therapy. Nanoscale Adv. 2021, 3, 302–310. [Google Scholar] [CrossRef]
- Zhao, K.; Li, D.; Cheng, G.; Zhang, B.; Han, J.; Chen, J.; Wang, B.; Li, M.; Xiao, T.; Zhang, J.; et al. Targeted Delivery Prodigiosin to Choriocarcinoma by Peptide-Guided Dendrigraft Poly-l-lysines Nanoparticles. Int. J. Mol. Sci. 2019, 20, 5458. [Google Scholar] [CrossRef] [Green Version]
- Männistö, M.; Vanderkerken, S.; Toncheva, V.; Elomaa, M.; Ruponen, M.; Schacht, E.; Urtti, A. Structure–activity relationships of poly(l-lysines): Effects of pegylation and molecular shape on physicochemical and biological properties in gene delivery. J. Control. Release 2002, 83, 169–182. [Google Scholar] [CrossRef]
- Golda, A.; Pelisek, J.; Klocke, R.; Engelmann, M.G.; Rolland, P.-H.; Mekkaoui, C.; Nikol, S. Small Poly-l-lysines improve cationic lipid-mediated gene transfer in vascular cells in vitro and in vivo. J. Vasc. Res. 2007, 44, 273–282. [Google Scholar] [CrossRef] [Green Version]
- Clements, B.A.; Incani, V.; Kucharski, C.; Lavasanifar, A.; Ritchie, B.; Uludağ, H. A comparative evaluation of poly-l-lysine-palmitic acid and Lipofectamine ™ 2000 for plasmid delivery to bone marrow stromal cells. Biomaterials 2007, 28, 4693–4704. [Google Scholar] [CrossRef] [PubMed]
- Klink, D.; Yu, Q.-C.; Glick, M.C.; Scanlin, T. Lactosylated poly-l-lysine targets a potential lactose receptor in cystic fibrosis and non-cystic fibrosis airway epithelial cells. Mol. Ther. 2003, 7, 73–80. [Google Scholar] [CrossRef] [PubMed]
- Choi, Y.H.; Liu, F.; Kim, J.-S.; Choi, Y.K.; Jong Sang, P.; Kim, S.W. Polyethylene glycol-grafted poly-l-lysine as polymeric gene carrier. J. Control. Release 1998, 54, 39–48. [Google Scholar] [CrossRef] [PubMed]
- Harada, A.; Togawa, H.; Kataoka, K. Physicochemical properties and nuclease resistance of antisense-oligodeoxynucleotides entrapped in the core of polyion complex micelles composed of poly(ethylene glycol)–poly(l-Lysine) block copolymers. Eur. J. Pharm. Sci. 2001, 13, 35–42. [Google Scholar] [CrossRef] [PubMed]
- Zhou, D.; Li, C.; Hu, Y.; Zhou, H.; Chen, J.; Zhang, Z.; Guo, T. Glycopolymer modification on physicochemical and biological properties of poly(l-lysine) for gene delivery. Int. J. Biol. Macromol. 2012, 50, 965–973. [Google Scholar] [CrossRef] [PubMed]
- Putnam, D.; Gentry, C.A.; Pack, D.W.; Langer, R. Polymer-based gene delivery with low cytotoxicity by a unique balance of side-chain termini. Proc. Natl. Acad. Sci. USA 2001, 98, 1200–1205. [Google Scholar] [CrossRef] [PubMed]
- Bikram, M.; Ahn, C.-H.; Chae, S.Y.; Lee, M.; Yockman, J.W.; Kim, S.W. Biodegradable poly(ethylene glycol)-co-poly(l-lysine)-g-histidine multiblock copolymers for nonviral gene delivery. Macromolecules 2004, 37, 1903–1916. [Google Scholar] [CrossRef]
- Fajac, I.; Allo, J.-C.; Souil, E.; Merten, M.; Pichon, C.; Figarella, C.; Monsigny, M.; Briand, P.; Midoux, P. Histidylated polylysine as a synthetic vector for gene transfer into immortalized cystic fibrosis airway surface and airway gland serous cells. J. Gene Med. 2000, 2, 368–378. [Google Scholar] [CrossRef]
- Choi, S.; Lee, K.-D. Enhanced gene delivery using disulfide-crosslinked low molecular weight polyethylenimine with listeriolysin o-polyethylenimine disulfide conjugate. J. Control. Release 2008, 131, 70–76. [Google Scholar] [CrossRef] [Green Version]
- Oupický, D.; Carlisle, R.C.; Seymour, L.W. Triggered intracellular activation of disulfide crosslinked polyelectrolyte gene delivery complexes with extended systemic circulation in vivo. Gene Ther. 2001, 8, 713–724. [Google Scholar] [CrossRef] [Green Version]
- Sun, W.; Davis, P.B. Reducible DNA nanoparticles enhance in vitro gene transfer via an extracellular mechanism. J. Control. Release 2010, 146, 118–127. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yang, J.; Wang, H.-Y.; Yi, W.-J.; Gong, Y.-H.; Zhou, X.; Zhuo, R.-X.; Zhang, X.-Z. PEGylated peptide based reductive polycations as efficient nonviral gene vectors. Adv. Healthc. Mater. 2013, 2, 481–489. [Google Scholar] [CrossRef]
- Liu, Y.; He, X.; Kuang, Y.; An, S.; Wang, C.; Guo, Y.; Ma, H.; Lou, J.; Jiang, C. A bacteria deriving peptide modified dendrigraft poly-l-lysines (dgl) self-assembling nanoplatform for targeted gene delivery. Mol. Pharm. 2014, 11, 3330–3341. [Google Scholar] [CrossRef] [PubMed]
- Hofman, J.; Buncek, M.; Haluza, R.; Streinz, L.; Ledvina, M.; Cigler, P. In vitro transfection mediated by dendrigraft poly(l-lysines): The effect of structure and molecule size. Macromol. Biosci. 2013, 13, 167–176. [Google Scholar] [CrossRef] [PubMed]
- Ye, L.; Liu, H.; Fei, X.; Ma, D.; He, X.; Tang, Q.; Zhao, X.; Zou, H.; Chen, X.; Kong, X.; et al. Enhanced endosomal escape of dendrigraft poly-L-lysine polymers for the efficient gene therapy of breast cancer. Nano Res. 2021, 15, 1135–1144. [Google Scholar] [CrossRef]
- Tang, M.; Dong, H.; Li, Y.; Ren, T. Harnessing the PEG-cleavable strategy to balance cytotoxicity, intracellular release and the therapeutic effect of dendrigraft poly-l-lysine for cancer gene therapy. J. Mater. Chem. B 2016, 4, 1284–1295. [Google Scholar] [CrossRef]
- Yao, H.; Wang, K.; Wang, Y.; Wang, S.; Li, J.; Lou, J.; Ye, L.; Yan, X.; Lu, W.; Huang, R. Enhanced blood–brain barrier penetration and glioma therapy mediated by a new peptide modified gene delivery system. Biomaterials 2015, 37, 345–352. [Google Scholar] [CrossRef]
- Nakase, I.; Akita, H.; Kogure, K.; Gräslund, A.; Langel, Ü.; Harashima, H.; Futaki, S. Efficient Intracellular Delivery of Nucleic Acid Pharmaceuticals Using Cell-Penetrating Peptides. Acc. Chem. Res. 2011, 45, 1132–1139. [Google Scholar] [CrossRef]
- Kato, T.; Oba, M.; Nishida, K.; Tanaka, M. Cell-penetrating helical peptides having l-arginines and five-membered ring α,α-disubstituted α-amino acids. Bioconjug. Chem. 2014, 25, 1761–1768. [Google Scholar] [CrossRef]
- Oba, M.; Demizu, Y.; Yamashita, H.; Kurihara, M.; Tanaka, M. Plasmid DNA delivery using fluorescein-labeled arginine-rich peptides. Bioorg. Med. Chem. 2015, 23, 4911–4918. [Google Scholar] [CrossRef] [Green Version]
- Ramsay, E.; Hadgraft, J.; Birchall, J.; Gumbleton, M. Examination of the biophysical interaction between plasmid DNA and the polycations, polylysine and polyornithine, as a basis for their differential gene transfection in-vitro. Int. J. Pharm. 2000, 210, 97–107. [Google Scholar] [CrossRef]
- Thomas, B.J.; Lucas, P.; Moss, S.H. Transfection of melanoma cells using DNA-polylysine complexes: Polymer composition affects expression of reporter gene. Eur. J. Pharm. Sei. 1996, 4, 70. [Google Scholar] [CrossRef]
- Dong, Y.; Skoultchi, A.I.; Pollardl, J.W. Efficient DNA transfection of quiescent mammalian cells using poly-L-ornithine. Nucleic Acids Res. 1993, 21, 771–772. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Brown, M.D.; Schatzlein, A.; Brownlie, A.; Jack, V.; Wang, W.; Tetley, L.; Gray, A.I.; Uchegbu, I.F. Preliminary characterization of novel amino acid based polymeric vesicles as gene and drug delivery agents. Bioconjug. Chem. 2000, 11, 880–891. [Google Scholar] [CrossRef]
- Cai, M.; Zhang, Z.; Su, X.; Dong, H.; Zhong, Z.; Zhuo, R. Guanidinated multi-arm star polyornithines with a polyethylenimine core for gene delivery. Polymer 2014, 55, 4634–4640. [Google Scholar] [CrossRef]
- Palchetti, S.; Digiacomo, L.; Giulimondi, F.; Pozzi, D.; Peruzzi, G.; Ferri, G.; Amenitsch, H.; Cardarelli, F.; Mahmoudi, M.; Caracciolo, G. A mechanistic explanation of the inhibitory role of the protein corona on liposomal gene expression. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183159. [Google Scholar] [CrossRef] [PubMed]
- Dirisala, A.; Uchida, S.; Toh, K.; Li, J.; Osawa, S.; Tockary, T.A.; Liu, X.; Abbasi, S.; Hayashi, K.; Mochida, Y.; et al. Transient stealth coating of liver sinusoidal wall by anchoring two-armed PEG for retargeting nanomedicines. Sci. Adv. 2020, 6, eabb8133. [Google Scholar] [CrossRef]
- Mishra, S.; Webster, P.; Davis, M.E. PEGylation significantly affects cellular uptake and intracellular trafficking of non-viral gene delivery particles. Eur. J. Cell Biol. 2004, 83, 97–111. [Google Scholar] [CrossRef]
- Dirisala, A.; Osada, K.; Chen, Q.; Tockary, T.A.; Machitani, K.; Osawa, S.; Liu, X.; Ishii, T.; Miyata, K.; Oba, M.; et al. Optimized rod length of polyplex micelles for maximizing transfection efficiency and their performance in systemic gene therapy against stroma-rich pancreatic tumors. Biomaterials 2014, 35, 5359–5368. [Google Scholar] [CrossRef] [Green Version]
- Stanbridge, L.J.; Dussupt, V.; Maitland, N.J. Baculoviruses as vectors for gene therapy against human prostate cancer. J. Biomed. Biotechnol. 2003, 2003, 79–91. [Google Scholar] [CrossRef] [Green Version]
- Yu, C.-h.; Law, J.B.K.; Suryana, M.; Low, H.Y.; Sheetz, M.P. Early integrin binding to Arg-Gly-Asp peptide activates actin polymerization and contractile movement that stimulates outward translocation. Proc. Natl. Acad. Sci. USA 2011, 108, 20585–20590. [Google Scholar] [CrossRef]
- Ruoslahti, E.; Duza, T.; Zhang, L. Vascular homing peptides with cell-penetrating properties. Curr. Pharm. Des. 2005, 11, 3655–3660. [Google Scholar] [CrossRef]
- Essler, M.; Ruoslahti, E. Molecular specialization of breast vasculature: A breast-homing phage-displayed peptide binds to aminopeptidase P in breast vasculature. Proc. Natl. Acad. Sci. USA 2002, 99, 2252–2257. [Google Scholar] [CrossRef]
- Tyler-McMahon, B.M.; Boules, M.; Richelson, E. Neurotensin: Peptide for the next millennium. Regul. Pept. 2000, 93, 125–136. [Google Scholar] [CrossRef] [PubMed]
- Martinez-Fong, D.; Navarro-Quiroga, I.; Ochoa, I.; Alvarez-Maya, I.; Meraz, M.A.; Luna, J.; Arias-Montaño, J.-A. Neurotensin-SPDP-poly-l-lysine conjugate: A nonviral vector for targeted gene delivery to neural cells. Mol. Brain Res. 1999, 69, 249–262. [Google Scholar] [CrossRef]
- Nah, J.-W.; Yu, L.; Han, S.-o.; Ahn, C.-H.; Kim, S.W. Artery wall binding peptide-poly(ethylene glycol)-grafted-poly(l-lysine)-based gene delivery to artery wall cells. J. Control. Release 2002, 78, 273–284. [Google Scholar] [CrossRef]
- Pasqualini, R.; Koivunen, E.; Kain, R.; Lahdenranta, J.; Sakamoto, M.; Stryhn, A.; Ashmun, R.A.; Shapiro, L.H.; Arap, W.; Ruoslahti, E. Aminopeptidase N is a receptor for tumor-homing peptides and a target for inhibiting angiogenesis. Cancer Res. 2000, 60, 722–727. [Google Scholar]
- Moffatt, S.; Wiehle, S.; Cristiano, R.J. Tumor-specific gene delivery mediated by a novel peptide-polyethylenimine-DNA polyplex targeting aminopeptidase N/CD13. Hum. Gene Ther. 2005, 16, 57–67. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.; Chen, W.; Xie, H.; Wei, X.; Yin, S.; Zhou, L.; Xu, X.; Zheng, S. Biocompatible, chimeric peptide-condensed supramolecular nanoparticles for tumor cell-specific siRNA delivery and gene silencing. Chem. Commun. 2014, 50, 7806–7809. [Google Scholar] [CrossRef]
- Hong, H.-y.; Lee, H.Y.; Kwak, W.; Yoo, J.; Na, M.-H.; So, I.S.; Kwon, T.-H.; Park, H.-S.; Huh, S.; Oh, G.T.; et al. Phage display selection of peptides that home to atherosclerotic plaques: IL-4 receptor as a candidate target in atherosclerosis. J. Cell Mol. Med. 2008, 12, 2003–2014. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yi, A.; Sim, D.; Lee, Y.-J.; Sarangthem, V.; Park, R.-W. Development of elastin-like polypeptide for targeted specific gene delivery in vivo. J. Nanobiotechnol. 2020, 18, 15. [Google Scholar] [CrossRef] [PubMed]
- Meng, Z.; Kang, Z.; Sun, C.; Yang, S.; Zhao, B.; Feng, S.; Meng, Q.; Liu, K. Enhanced gene transfection efficiency by use of peptide vectors containing laminin receptor-targeting sequence YIGSR. Nanoscale 2018, 10, 1215–1227. [Google Scholar] [CrossRef]
- Ren, H.; Zhou, L.; Liu, M.; Lu, W.; Gao, C. Peptide GE11–Polyethylene Glycol–Polyethylenimine for targeted gene delivery in laryngeal cancer. Med. Oncol. 2015, 32, 185. [Google Scholar] [CrossRef]
- Ping, Y.; Hu, Q.; Tang, G.; Li, J. FGFR-targeted gene delivery mediated by supramolecular assembly between β-cyclodextrin-crosslinked PEI and redox-sensitive PEG. Biomaterials 2013, 34, 6482–6494. [Google Scholar] [CrossRef]
- Yu, M.-Z.; Pang, W.-H.; Yang, T.; Wang, J.-C.; Wei, L.; Qiu, C.; Wu, Y.-F.; Liu, W.-Z.; Wei, W.; Guo, X.-Y.; et al. Systemic delivery of siRNA by T7 peptide modified core-shell nanoparticles for targeted therapy of breast cancer. Eur. J. Pharm. Sci. 2016, 92, 39–48. [Google Scholar] [CrossRef]
- Borrelli, A.; Tornesello, A.; Tornesello, M.; Buonaguro, F. Cell penetrating peptides as molecular carriers for anti-cancer agents. Molecules 2018, 23, 295. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Habault, J.; Poyet, J.-L. Recent advances in cell penetrating peptide-based anticancer therapies. Molecules 2019, 24, 927. [Google Scholar] [CrossRef] [Green Version]
- Copolovici, D.M.; Langel, K.; Eriste, E.; Langel, Ü. Cell-penetrating peptides: Design, synthesis, and applications. ACS Nano 2014, 8, 1972–1994. [Google Scholar] [CrossRef]
- Heitz, F.; Morris, M.C.; Divita, G. Twenty years of cell-penetrating peptides: From molecular mechanisms to therapeutics. Br. J. Pharmacol. 2009, 157, 195–206. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Howl, J.; Nicholl, I.D.; Jones, S. The many futures for cell-penetrating peptides: How soon is now? Biochem. Soc. Trans. 2007, 35, 767–769. [Google Scholar] [CrossRef] [Green Version]
- Suzuki, T.; Futaki, S.; Niwa, M.; Tanaka, S.; Ueda, K.; Sugiura, Y. Possible existence of common internalization mechanisms among arginine-rich peptides. J. Biol. Chem. 2002, 277, 2437–2443. [Google Scholar] [CrossRef] [Green Version]
- Won, Y.-W.; Kim, H.A.; Lee, M.; Kim, Y.-H. Reducible Poly(oligo-D-arginine) for enhanced gene expression in mouse lung by intratracheal injection. Mol. Ther. 2010, 18, 734–742. [Google Scholar] [CrossRef]
- Chen, S.; Han, K.; Yang, J.; Lei, Q.; Zhuo, R.-X.; Zhang, X.-Z. Bioreducible polypeptide containing cell-penetrating sequence for efficient gene delivery. Pharm. Res. 2013, 30, 1968–1978. [Google Scholar] [CrossRef] [PubMed]
- Chen, S.; Rong, L.; Jia, H.-Z.; Qin, S.-Y.; Zeng, X.; Zhuo, R.-X.; Zhang, X.-Z. Co-delivery of proapoptotic peptide and p53 DNA by reduction-sensitive polypeptides for cancer therapy. Biomater. Sci. 2015, 3, 753–763. [Google Scholar] [CrossRef] [PubMed]
- Alexis, F.; Lo, S.L.; Wang, S. Covalent attachment of low molecular weight poly(ethylene imine) improves tat peptide mediated gene delivery. Adv. Mater. 2006, 18, 2174–2178. [Google Scholar] [CrossRef]
- Oehlke, J.; Scheller, A.; Wiesner, B.; Krause, E.; Beyermann, M.; Klauschenz, E.; Melzig, M.; Bienert, M. Cellular uptake of an α-helical amphipathic model peptide with the potential to deliver polar compounds into the cell interior non-endocytically. Biochim. Biophys. Acta 1998, 1414, 127–139. [Google Scholar] [CrossRef] [Green Version]
- Bahadoran, A.; Moeini, H.; Bejo, M.H.; Hussein, M.Z.; Omar, A.R. Development of Tat-conjugated dendrimer for transdermal dna vaccine delivery. J. Pharm. Pharm. Sci. 2016, 19, 325–338. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Niu, J.; Chu, Y.; Huang, Y.-F.; Chong, Y.-S.; Jiang, Z.-H.; Mao, Z.-W.; Peng, L.-H.; Gao, J.-Q. Transdermal gene delivery by functional peptide-conjugated cationic gold nanoparticle reverses the progression and metastasis of cutaneous melanoma. ACS Appl. Mater. Interfaces 2017, 9, 9388–9401. [Google Scholar] [CrossRef]
- Kilk, K.; El-Andaloussi, S.; Järver, P.; Meikas, A.; Valkna, A.; Bartfai, T.; Kogerman, P.; Metsis, M.; Langel, Ü. Evaluation of transportan 10 in PEI mediated plasmid delivery assay. J. Control. Release 2005, 103, 511–523. [Google Scholar] [CrossRef] [PubMed]
- Degors, I.M.S.; Wang, C.; Rehman, Z.U.; Zuhorn, I.S. Carriers break barriers in drug delivery: Endocytosis and endosomal escape of gene delivery vectors. Acc. Chem. Res. 2019, 52, 1750–1760. [Google Scholar] [CrossRef] [Green Version]
- Wojnilowicz, M.; Glab, A.; Bertucci, A.; Caruso, F.; Cavalieri, F. Super-resolution imaging of proton sponge-triggered rupture of endosomes and cytosolic release of small interfering RNA. ACS Nano 2018, 13, 187–202. [Google Scholar] [CrossRef] [PubMed]
- Brock, D.J.; Kondow-McConaghy, H.M.; Hager, E.C.; Pellois, J.-P. Endosomal escape and cytosolic penetration of macromolecules mediated by synthetic delivery agents. Bioconjug. Chem. 2018, 30, 293–304. [Google Scholar] [CrossRef] [PubMed]
- Varkouhi, A.K.; Scholte, M.; Storm, G.; Haisma, H.J. Endosomal escape pathways for delivery of biologicals. J. Control. Release 2011, 151, 220–228. [Google Scholar] [CrossRef]
- Kichler, A.; Mason, A.J.; Bechinger, B. Cationic amphipathic histidine-rich peptides for gene delivery. Biochim. Biophys. Acta 2006, 1758, 301–307. [Google Scholar] [CrossRef] [Green Version]
- Chen, Q.R. Optimal transfection with the HK polymer depends on its degree of branching and the pH of endocytic vesicles. Nucleic Acids Res. 2002, 30, 1338–1345. [Google Scholar] [CrossRef] [PubMed]
- Leng, Q. Modified branched peptides with a histidine-rich tail enhance in vitro gene transfection. Nucleic Acids Res. 2005, 33, e40. [Google Scholar] [CrossRef] [Green Version]
- Lo, S.L.; Wang, S. An endosomolytic Tat peptide produced by incorporation of histidine and cysteine residues as a nonviral vector for DNA transfection. Biomaterials 2008, 29, 2408–2414. [Google Scholar] [CrossRef]
- McErlean, E.M.; Ziminska, M.; McCrudden, C.M.; McBride, J.W.; Loughran, S.P.; Cole, G.; Mulholland, E.J.; Kett, V.; Buckley, N.E.; Robson, T.; et al. Rational design and characterisation of a linear cell penetrating peptide for non-viral gene delivery. J. Control. Release 2021, 330, 1288–1299. [Google Scholar] [CrossRef]
- Selbo, P.K.; Weyergang, A.; Høgset, A.; Norum, O.-J.; Berstad, M.B.; Vikdal, M.; Berg, K. Photochemical internalization provides time- and space-controlled endolysosomal escape of therapeutic molecules. J. Control. Release 2010, 148, 2–12. [Google Scholar] [CrossRef]
- Han, K.; Lei, Q.; Jia, H.-Z.; Wang, S.-B.; Yin, W.-N.; Chen, W.-H.; Cheng, S.-X.; Zhang, X.-Z. A tumor targeted chimeric peptide for synergistic endosomal escape and therapy by dual-stage light manipulation. Adv. Funct. Mater. 2015, 25, 1248–1257. [Google Scholar] [CrossRef]
- Boeckle, S.; Wagner, E.; Ogris, M. C- versus N-terminally linked melittin-polyethylenimine conjugates: The site of linkage strongly influences activity of DNA polyplexes. J. Gene Med. 2005, 7, 1335–1347. [Google Scholar] [CrossRef] [PubMed]
- Schellinger, J.G.; Pahang, J.A.; Johnson, R.N.; Chu, D.S.H.; Sellers, D.L.; Maris, D.O.; Convertine, A.J.; Stayton, P.S.; Horner, P.J.; Pun, S.H. Melittin-grafted HPMA-oligolysine based copolymers for gene delivery. Biomaterials 2013, 34, 2318–2326. [Google Scholar] [CrossRef] [Green Version]
- Lochmann, D.; Jauk, E.; Zimmer, A. Drug delivery of oligonucleotides by peptides. Eur. J. Pharm. Biopharm. 2004, 58, 237–251. [Google Scholar] [CrossRef]
- Miura, N.; Tange, K.; Nakai, Y.; Yoshioka, H.; Harashima, H.; Akita, H. Identification and evaluation of the minimum unit of a KALA peptide required for gene delivery and immune activation. J. Pharm. Sci. 2017, 10, 3113–3119. [Google Scholar] [CrossRef] [Green Version]
- Miura, N.; Shaheen, S.M.; Akita, H.; Nakamura, T.; Harashima, H. A KALA-modified lipid nanoparticle containing CpG-free plasmid DNA as a potential DNA vaccine carrier for antigen presentation and as an immune-stimulative adjuvant. Nucleic Acids Res. 2015, 43, 1317–1331. [Google Scholar] [CrossRef] [Green Version]
- Alber, F.; Dokudovskaya, S.; Veenhoff, L.M.; Zhang, W.; Kipper, J.; Devos, D.; Suprapto, A.; Karni-Schmidt, O.; Williams, R.; Chait, B.T.; et al. The molecular architecture of the nuclear pore complex. Nature 2007, 450, 695–701. [Google Scholar] [CrossRef] [PubMed]
- Zanta, M.A.; Belguise-Valladier, P.; Behr, J.-P. Gene delivery: A single nuclear localization signal peptide is sufficient to carry DNA to the cell nucleus. Proc. Natl. Acad. Sci. USA 1999, 96, 91–96. [Google Scholar] [CrossRef]
- van der Aa, M.A.E.M.; Mastrobattista, E.; Oosting, R.S.; Hennink, W.E.; Koning, G.A.; Crommelin, D.J.A. The nuclear pore complex: The gateway to successful nonviral gene delivery. Pharm. Res. 2006, 23, 447–459. [Google Scholar] [CrossRef] [PubMed]
- Fontes, M.R.M.; Teh, T.; Kobe, B. Structural basis of recognition of monopartite and bipartite nuclear localization sequences by mammalian importin-α11Edited by K. Nagai. J. Mol. Biol. 2000, 297, 1183–1194. [Google Scholar] [CrossRef]
- Yu, J.; Xie, X.; Zheng, M.; Yu, L.; Zhang, L.; Zhao, J.; Jiang, D.; Che, X. Fabrication and characterization of nuclear localization signal-conjugated glycol chitosan micelles for improving the nuclear delivery of doxorubicin. Int. J. Nanomed. 2012, 7, 5079–5090. [Google Scholar] [CrossRef] [Green Version]
- van der Aa, M.A.E.M.; Koning, G.A.; d’Oliveira, C.; Oosting, R.S.; Wilschut, K.J.; Hennink, W.E.; Crommelin, D.J.A. An NLS peptide covalently linked to linear DNA does not enhance transfection efficiency of cationic polymer based gene delivery systems. J. Gene Med. 2005, 7, 208–217. [Google Scholar] [CrossRef] [PubMed]
- Escriou, V.; Carrière, M.; Scherman, D.; Wils, P. NLS bioconjugates for targeting therapeutic genes to the nucleus. Adv. Drug Deliv. Rev. 2003, 55, 295–306. [Google Scholar] [CrossRef] [PubMed]
- Hu, Q.; Wang, J.; Shen, J.; Liu, M.; Jin, X.; Tang, G.; Chu, P.K. Intracellular pathways and nuclear localization signal peptide-mediated gene transfection by cationic polymeric nanovectors. Biomaterials 2012, 33, 1135–1145. [Google Scholar] [CrossRef]
- Wang, H.-Y.; Chen, J.-X.; Sun, Y.-X.; Deng, J.-Z.; Li, C.; Zhang, X.-Z.; Zhuo, R.-X. Construction of cell penetrating peptide vectors with N-terminal stearylated nuclear localization signal for targeted delivery of DNA into the cell nuclei. J. Control. Release 2011, 155, 26–33. [Google Scholar] [CrossRef] [PubMed]
- Xu, Y.; Liang, W.; Qiu, Y.; Cespi, M.; Palmieri, G.F.; Mason, A.J.; Lam, J.K.W. Incorporation of a nuclear localization signal in pH responsive LAH4-L1 peptide enhances transfection and nuclear uptake of plasmid DNA. Mol. Pharm. 2016, 13, 3141–3152. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cheng, Y.; Sun, C.; Liu, R.; Yang, J.; Dai, J.; Zhai, T.; Lou, X.; Xia, F. A Multifunctional peptide-conjugated aiegen for efficient and sequential targeted gene delivery into the nucleus. Angew. Chem. Int. Ed. 2019, 58, 5049–5053. [Google Scholar] [CrossRef]
- Wu, Y.; Tang, Y.; Xie, S.; Zheng, X.; Zhang, S.; Mao, J.; Wang, B.; Hou, Y.; Hu, L.; Chai, K.; et al. Chimeric peptide supramolecular nanoparticles for plectin-1 targeted miRNA-9 delivery in pancreatic cancer. Theranostics 2020, 10, 1151–1165. [Google Scholar] [CrossRef]
- Zhang, C.; Wu, W.; Li, R.Q.; Qiu, W.X.; Zhuang, Z.N.; Cheng, S.X.; Zhang, X.Z. Peptide-based multifunctional nanomaterials for tumor imaging and therapy. Adv. Funct. Mater. 2018, 28, 1804492. [Google Scholar] [CrossRef]
- Chen, W.; Zhou, Y.; Zhi, X.; Ma, T.; Liu, H.; Chen, B.W.; Zheng, X.; Xie, S.; Zhao, B.; Feng, X.; et al. Delivery of miR-212 by chimeric peptide-condensed supramolecular nanoparticles enhances the sensitivity of pancreatic ductal adenocarcinoma to doxorubicin. Biomaterials 2019, 192, 590–600. [Google Scholar] [CrossRef]
- Qu, W.; Qin, S.-Y.; Ren, S.; Jiang, X.-J.; Zhuo, R.-X.; Zhang, X.-Z. Peptide-based vector of VEGF plasmid for efficient gene delivery in vitro and vessel formation in vivo. Bioconjug. Chem. 2013, 24, 960–967. [Google Scholar] [CrossRef]
- Luan, L.; Meng, Q.; Xu, L.; Meng, Z.; Yan, H.; Liu, K. Peptide amphiphiles with multifunctional fragments promoting cellular uptake and endosomal escape as efficient gene vectors. J. Mater. Chem. B 2015, 3, 1068–1078. [Google Scholar] [CrossRef] [PubMed]
- Chen, S.; Lei, Q.; Li, S.-Y.; Qin, S.-Y.; Jia, H.-Z.; Cheng, Y.-J.; Zhang, X.-Z. Fabrication of dual responsive co-delivery system based on three-armed peptides for tumor therapy. Biomaterials 2016, 92, 25–35. [Google Scholar] [CrossRef] [PubMed]
Name | Receptor | Sequence |
---|---|---|
RGD | Integrin receptors | RGD-containing peptides |
REDV | Integrin receptors | REDV |
YIGSR | Laminin receptor | YIGSR |
GE11 | Epidermal growth factor receptor (EGFR) | YHWYGYTPQNVIGRC |
GE7 | Epidermal growth factor receptor (EGFR) | YHWYGYTPQNVI-GG)2-KGRC |
MQLPLAT | Fibroblast growth factor receptor (FGFR) | MQLPLAT |
MC11 | Fibroblast growth factor receptor (FGFR) | MQLPLATGGGC |
T7 | Transferrin receptor | HAIYPRH |
B6 | Transferrin receptor | GHKAKGPRK |
B18 | Transferrin receptor | SPRPRHTLRLSL |
Angiopep-2 | Low-density lipoprotein-receptor-related protein (LRP-1) | TFFYGGSRGKRNNFKTEEY |
NGR | CD13 protein | NGR |
SP94 | Human hepatocellular carcinoma (HCC) | SFSIIHTPILPL |
CAGW | Endothelial cells (Ecs) | CAGW |
SP peptide | Neurokinin-1 (NK-1) receptor | RPKPQQFFGLM |
RP | Neuropilin-1 (NRP-1) receptor | RPARPAR |
VHPK | Vascular cell adhesion molecule 1 (VCAM1) | VHPKQHR |
GRP | Gastrin releasing receptor | CGGNHWAVGHLM |
IF7 | Annexin-1 specific | IFLLWQR |
EphA | Pancreatic cells | CHVLWSTRC |
CPP Name | Sequence |
---|---|
TAT(48–57) | GRKKRRQRRR |
Penetratin | RQIKWFQNRRMKWKK |
MAP | KLALKLALKALKAALKLA a |
Transportan/TP10 | GWTLNSAGYLLGKINLKALAALAKKIL a |
VP22 | NAKTRRHERRRKLAIER |
Polyarginine | Rn a n = 8, 9 |
MPG | GALFLGFLGAAGSTMGA b |
Pep-1 | KETWWETWWTEWSQPKKKRKV b |
pVEC | LLIILRRRIRKQAHAHSK a |
YTA2 | YTAIAWVKAFIRKLRK a |
YTA4 | IAWVKAFIRKLRKGPLG a |
M918 | MVTVLFRRLRIRRACGPPRVRV a |
CADY | GLWRALWRLLRSLWRLLWRA b |
SAP | (VRLPPP)3 |
PTD-5 | RRQRRTSKLMKR |
Mgpe-9 | CRRLRHLRHHYRRRWHRFRC |
SynB | RGGRLSYSRRRFSTSTGR |
Name | Sequence |
---|---|
KALA | WKAALAKALAKALAKHLAKALAKALKALAA |
GALA | WEAALAEALAEALAEHLAEALAEALEALAA |
LK15 | KLLKLLLKLLLKLLK |
sHGP | RGWEVLKYWWNLLQY |
INF7 | GLFEAIEGFIENGWEGMIWDYG |
VP1 | NPVENYIDEVLNEVLVVPNINSSNC |
Melittin | GAVLKVLTTGLPALISWIKRKRQQ |
Magainin2 | GLGKFLHSAKKFGKAFVGEIMNS |
H5WYG | GLFHAIAHFIHGGWHGLIHGWYG |
HA2 | GLFGAIAGFIENGWEGMIDG |
NLS | Sequence |
---|---|
SVT40 | PKKKRKV |
H2B | GKKRSKV |
V-Jun | KSRKRKL |
Dorsal | RRKRQR |
Nucleop lasmin | KRPAATKKAGQAKKKKLDK |
NIN2 | RKKRKTEEESLKDKAKKSK |
SWI5 | KKYENVVIKRSPPKRGRPRK |
RB | RKKKPK-12X-KKSK |
PTHrP | YLTQEINKVETYKEQPLKTPGRP |
M9 | NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY |
Pho4 | SANKVTKNKSNSSPYLNKRKGKPGPDS |
RpL23a | VKSHKKKKIRTSPTFTIPKTLTLRRQPKYPRKSAPRRNKLDHY |
RpL25 | MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTKLAR |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Yang, J.; Luo, G.-F. Peptide-Based Vectors for Gene Delivery. Chemistry 2023, 5, 1696-1718. https://0-doi-org.brum.beds.ac.uk/10.3390/chemistry5030116
Yang J, Luo G-F. Peptide-Based Vectors for Gene Delivery. Chemistry. 2023; 5(3):1696-1718. https://0-doi-org.brum.beds.ac.uk/10.3390/chemistry5030116
Chicago/Turabian StyleYang, Juan, and Guo-Feng Luo. 2023. "Peptide-Based Vectors for Gene Delivery" Chemistry 5, no. 3: 1696-1718. https://0-doi-org.brum.beds.ac.uk/10.3390/chemistry5030116